Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05655A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOL6 |
| Target Synonyms | NRAP; UTP22; bA311H10.1; NOL6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Mouse brain, Mouse liver, Mouse lung, Rat lung, SGC-7901, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV | Uniprot ID | Q9H6R4 |
Uniprot Id
Q9H6R4
Target Species
Human
Target Name
NOL6
Target Full Name
Nucleolar protein 6
Target Subcellular Location
Nucleus, nucleolus. Chromosome.
Target Protein Families
NRAP family
Target Synonyms
NOL6; Nucleolar protein 6; Nucleolar RNA-associated protein; Nrap
Target Background
The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
