-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NR4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human NR4A2 (NP_006177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NR4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human NR4A2 (NP_006177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10651A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NR4A2 |
| Target Synonyms | NOT; RNR1; HZF-3; IDLDP; NURR1; TINUR; NR4A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human NR4A2 (NP_006177.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPV | Uniprot ID | P43354 |
Uniprot Id
P43354
Target Species
Human
Target Name
NR4A2
Target Full Name
Nuclear receptor subfamily 4 group A member 2
Target Function
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Mostly nuclear; oxidative stress promotes cytoplasmic localization.
Target Protein Families
Nuclear hormone receptor family, NR4 subfamily
Target Tissue Specificity
Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Target Research Area
Cancer
Target Synonyms
HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
Target Background
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Notification