Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUSAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human NUSAP1 (NP_060924.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUSAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human NUSAP1 (NP_060924.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10022A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUSAP1 |
| Target Synonyms | LNP; ANKT; SAPL; BM037; NUSAP; Q0310; PRO0310p1; NUSAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human NUSAP1 (NP_060924.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSA | Uniprot ID | Q9BXS6 |
Uniprot Id
Q9BXS6
Target Species
Human
Target Name
NUSAP1
Target Full Name
Nucleolar and spindle-associated protein 1
Target Function
Microtubule-associated protein with the capacity to bundle and stabilize microtubules. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
Target Subcellular Location
Cytoplasm. Nucleus, nucleolus. Cytoplasm, cytoskeleton, spindle. Chromosome.
Target Protein Families
NUSAP family
Target Synonyms
2610201A12Rik; AI481307; ANKT; AW547774; BB165529; BM037; FLJ13421; LNP; Nucleolar and spindle associated protein 1; Nucleolar and spindle-associated protein 1; Nucleolar protein ANKT; NuSAP; NUSAP_HUMAN; nusap1; PRO0310p1; Q0310; RP23-22A15.4; SAPL
Target Background
NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
