-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OASL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 315-514 of human OASL (NP_003724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OASL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 315-514 of human OASL (NP_003724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01616A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OASL |
| Target Synonyms | OASL1; OASLd; TRIP14; TRIP-14; p59OASL; p59 OASL; p59-OASL; OASL | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 315-514 of human OASL (NP_003724.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRARDIHLTVEQRGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFSHTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGEALFPAS | Uniprot ID | Q15646 |
Uniprot Id
Q15646
Target Species
Human
Target Name
OASL
Target Full Name
2'-5'-oligoadenylate synthase-like protein
Target Function
Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
Target Subcellular Location
[Isoform p56]: Nucleus, nucleolus. Cytoplasm.; [Isoform p30]: Cytoplasm.
Target Protein Families
2-5A synthase family
Target Tissue Specificity
Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.
Target Research Area
Cell Biology
Target Synonyms
2' 5' oligoadenylate synthetase like; 2''-5''-OAS-related protein; 2''-5''-OAS-RP; 2''-5''-oligoadenylate synthase-like protein; 2'-5' oligoadenylate synthetase-like 2; 2'-5'-oligoadenylate synthetase-like; 59 kDa 2' 5' oligoadenylate synthetase like protein; 59 kDa 2''-5''-oligoadenylate synthase-like protein; 59 kDa 2'-5'-oligoadenylate synthetase-like protein; M1204; Mmu-OASL; OASL; OASL_HUMAN; Oasl2; p59 OASL; p59OASL; THYROID HORMONE RECEPTOR INTERACTOR 14; Thyroid receptor interacting protein 14; Thyroid receptor-interacting protein 14; TR-interacting protein 14; TRIP-14; TRIP14
Target Background
Enables DNA binding activity and double-stranded RNA binding activity. Involved in several processes, including interleukin-27-mediated signaling pathway; negative regulation of viral genome replication; and positive regulation of RIG-I signaling pathway. Located in cytosol; nucleolus; and nucleoplasm.
Notification