Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Occludin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human Occludin (NP_002529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Occludin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human Occludin (NP_002529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse lung, using Occludin Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-13141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Occludin |
| Target Synonyms | BLCPMG; PTORCH1; PPP1R115; Occludin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human Occludin (NP_002529.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT | Uniprot ID | Q16625 |
Uniprot Id
Q16625
Target Species
Human
Target Name
OCLN
Target Full Name
Occludin
Target Function
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.; (Microbial infection) Acts as a co-receptor for hepatitis C virus (HCV) in hepatocytes.
Target Involvement
Pseudo-TORCH syndrome 1 (PTORCH1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Target Protein Families
ELL/occludin family
Target Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.
Target Synonyms
OCLN; Occludin
Target Background
This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
