-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OPN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human OPN3 (NP_055137.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OPN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human OPN3 (NP_055137.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11361A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OPN3 |
| Target Synonyms | ECPN; PPP1R116; OPN3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human OPN3 (NP_055137.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVR | Uniprot ID | Q9H1Y3 |
Uniprot Id
Q9H1Y3
Target Species
Human
Target Name
OPN3
Target Full Name
Opsin-3
Target Function
G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin. Binds both 11-cis retinal and all-trans retinal. Regulates melanogenesis in melanocytes via inhibition of alpha-MSH-induced MC1R-mediated cAMP signaling, modulation of calcium flux, regulation of CAMK2 phosphorylation, and subsequently phosphorylation of CREB, p38, ERK and MITF in response to blue light. Plays a role in melanocyte survival through regulation of intracellular calcium levels and subsequent BCL2/RAF1 signaling. Additionally regulates apoptosis via cytochrome c release and subsequent activation of the caspase cascade. Required for TYR and DCT blue light-induced complex formation in melanocytes. Involved in keratinocyte differentiation in response to blue-light. Required for the UVA-mediated induction of calcium and mitogen-activated protein kinase signaling resulting in the expression of MMP1, MMP2, MMP3, MMP9 and TIMP1 in dermal fibroblasts. Plays a role in light-mediated glucose uptake, mitochondrial respiration and fatty acid metabolism in brown adipocyte tissues. May be involved in photorelaxation of airway smooth muscle cells, via blue-light dependent GPCR signaling pathways.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm.
Target Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Target Tissue Specificity
Expressed in tracheal airway smooth muscle (at protein level). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level). Expressed in dermal fibroblasts (at protein level). Express
Target Synonyms
OPN3; ECPN; Opsin-3; Encephalopsin; Panopsin
Target Background
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly expressed in liver, placenta, heart, lung, skeletal muscle, kidney, and pancreas. The gene may also be expressed in the retina. The protein has the canonical features of a photoreceptive opsin protein.
Notification