-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OSMR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human OSMR (NP_003990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OSMR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human OSMR (NP_003990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11797A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OSMR |
| Target Synonyms | OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta; OSMR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human OSMR (NP_003990.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNL | Uniprot ID | Q99650 |
Uniprot Id
Q99650
Target Species
Human
Target Name
OSMR
Target Full Name
Oncostatin-M-specific receptor subunit beta
Target Function
Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.
Target Involvement
Amyloidosis, primary localized cutaneous, 1 (PLCA1)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 2 subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level). Expressed at relatively high levels in all neural cells as well as fibroblast and epithelial cells.
Target Synonyms
IL-31 receptor subunit beta; IL-31R subunit beta; IL-31R-beta; IL-31RB; Interleukin-31 receptor subunit beta; MGC140467; MGC150626; MGC150627; MGC75127; Oncostatin M receptor; Oncostatin M specific receptor subunit beta; Oncostatin M-specific receptor, beta; Oncostatin-M-specific receptor subunit beta; Osmr; OSMR_HUMAN; OSMRB
Target Background
This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification