-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P23/PTGES3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/P23/PTGES3 (NP_006592.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against P23/PTGES3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/P23/PTGES3 (NP_006592.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03829A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P23/PTGES3 |
| Target Synonyms | P23; TEBP; cPGES; P23/PTGES3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/P23/PTGES3 (NP_006592.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS | Uniprot ID | Q15185 |
Uniprot Id
Q15185
Target Species
Human
Target Name
PTGES3
Target Full Name
Prostaglandin E synthase 3
Target Function
Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.
Target Subcellular Location
Cytoplasm.
Target Protein Families
P23/wos2 family
Target Research Area
Cancer, metabolism
Target Synonyms
Co chaperone p23; cPGES; Cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; P23; Progesterone receptor complex; Progesterone receptor complex p23; Prostaglandin E synthase 3 (cytosolic); Prostaglandin E synthase 3; PTGES 3; PTGES3; Sid 3177; TEBP; TEBP_HUMAN; Telomerase binding protein p23; Telomerase-binding protein p23; Unactive progesterone receptor 23 kD
Target Background
This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.
Notification