-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCNT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human PCNT (NP_006022.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PCNT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human PCNT (NP_006022.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCNT |
| Target Synonyms | KEN; PCN; MOPD2; PCNT2; PCNTB; PCTN2; SCKL4; PCNT | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human PCNT (NP_006022.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT | Uniprot ID | O95613 |
Uniprot Id
O95613
Target Species
Human
Target Name
PCNT
Target Full Name
Pericentrin
Target Function
Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material (PCM). May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.
Target Involvement
Microcephalic osteodysplastic primordial dwarfism 2 (MOPD2)
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Centrosomal at all stages of the cell cycle. Remains associated with centrosomes following microtubule depolymerization. Colocalized with DISC1 at the centrosome.
Target Tissue Specificity
Expressed in all tissues tested, including placenta, liver, kidney and thymus.
Target Synonyms
Centrosome Marker; Ken; Kendrin; KIAA0402; MOPD2; PCN; PCNT 2; PCNT; PCNT B; PCNT_HUMAN; PCNT1; PCNT2; PCNTB; PCTN2; Pericentrin 1; Pericentrin 2; Pericentrin 380; Pericentrin; Pericentrin B; Pericentrin-B; SCKL4
Target Background
The protein encoded by this gene binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (PCM). The protein contains a series of coiled-coil domains and a highly conserved PCM targeting motif called the PACT domain near its C-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression. Mutations in this gene cause Seckel syndrome-4 and microcephalic osteodysplastic primordial dwarfism type II. Two transcript variants encoding different isoforms have been found for this gene.
Notification