-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PD-L1/CD274 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 190-290 of human PD-L1/CD274 (NP_054862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PD-L1/CD274 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 190-290 of human PD-L1/CD274 (NP_054862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13029A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PD-L1/CD274 |
| Target Synonyms | B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; PD-L1/CD274 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 190-290 of human PD-L1/CD274 (NP_054862.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET | Uniprot ID | Q9NZQ7 |
Uniprot Id
Q9NZQ7
Target Species
Human
Target Name
CD274
Target Full Name
Programmed cell death 1 ligand 1
Target Function
Plays a critical role in induction and maintenance of immune tolerance to self. As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response. Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10).; The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival. The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Early endosome membrane; Single-pass type I membrane protein. Recycling endosome membrane; Single-pass type I membrane protein.; [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Endomembrane system; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, BTN/MOG family
Target Tissue Specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
Target Research Area
Cancer
Target Synonyms
B7 H; B7 H1; B7 homolog 1; B7-H1; B7H; B7H1; CD 274; CD274; CD274 antigen; CD274 molecule; MGC142294; MGC142296; OTTHUMP00000021029 ; PD L1; PD-L1; PD1L1_HUMAN; PDCD1 ligand 1; PDCD1L1; PDCD1LG1; PDL 1; PDL1; Programmed cell death 1 ligand 1; Programmed death ligand 1; RGD1566211
Target Background
This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.
Notification