-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDK1/PDHK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDK1/PDHK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDK1/PDHK1 |
| Target Synonyms | PDK1; PDK1/PDHK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, HepG2, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA | Uniprot ID | Q15118 |
Uniprot Id
Q15118
Target Species
Human
Target Name
PDK1
Target Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
Target Function
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PDK/BCKDK protein kinase family
Target Tissue Specificity
Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.
Target Synonyms
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; HGNC:8809; Mitochondrial pyruvate dehydrogenase kinase isoenzyme 1; PDH kinase 1; Pdk1; PDK1_HUMAN; Pyruvate dehydrogenase kinase isoform 1; Pyruvate dehydrogenase kinase, isoenzyme 1
Target Background
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
Notification