Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pepsinogen II (PG II) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 73-172 of human Pepsinogen II (PG II) (NP_001159896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Pepsinogen II (PG II) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 73-172 of human Pepsinogen II (PG II) (NP_001159896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04268A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pepsinogen II (PG II) |
| Target Synonyms | PEPC; PGII; Pepsinogen II (PG II) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 73-172 of human Pepsinogen II (PG II) (NP_001159896.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFV | Uniprot ID | P20142 |
Uniprot Id
P20142
Target Species
Human
Target Name
PGC
Target Full Name
Gastricsin
Target Function
Hydrolyzes a variety of proteins.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase A1 family
Target Synonyms
PEPC; PGII; Pepsinogen II (PG II)
Target Background
This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
