-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGE receptor EP1 (PTGER1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PGE receptor EP1 (PTGER1) (P34995) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGE receptor EP1 (PTGER1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PGE receptor EP1 (PTGER1) (P34995) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04240A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGE receptor EP1 (PTGER1) |
| Target Synonyms | EP1; PGE receptor EP1 (PTGER1) | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PGE receptor EP1 (PTGER1) (P34995). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF | Uniprot ID | P34995 |
Uniprot Id
P34995
Target Species
Human
Target Name
PTGER1
Target Full Name
Prostaglandin E2 receptor EP1 subtype
Target Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Abundant in kidney. Lower level expression in lung, skeletal muscle and spleen, lowest expression in testis and not detected in liver brain and heart.
Target Synonyms
PTGER1; Prostaglandin E2 receptor EP1 subtype; PGE receptor EP1 subtype; PGE2 receptor EP1 subtype; Prostanoid EP1 receptor
Target Background
The protein encoded by this gene is a member of the G protein-coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). Through a phosphatidylinositol-calcium second messenger system, G-Q proteins mediate this receptor's activity. Knockout studies in mice suggested a role of this receptor in mediating algesia and in regulation of blood pressure. Studies in mice also suggested that this gene may mediate adrenocorticotropic hormone response to bacterial endotoxin.
Notification