-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHKA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 620-780 of human PHKA2 (NP_000283.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHKA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 620-780 of human PHKA2 (NP_000283.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00956A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHKA2 |
| Target Synonyms | PHK; PYK; XLG; PYKL; XLG2; GSD9A; PHKA2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HL-60, HT-29, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 620-780 of human PHKA2 (NP_000283.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPTKVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHGDVDCEKLVEQLKDCSNLQDQADIL | Uniprot ID | P46019 |
Uniprot Id
P46019
Target Species
Human
Target Name
PHKA2
Target Full Name
Phosphorylase b kinase regulatory subunit alpha, liver isoform
Target Function
Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.
Target Involvement
Glycogen storage disease 9A (GSD9A)
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Phosphorylase b kinase regulatory chain family
Target Tissue Specificity
Predominantly expressed in liver and other non-muscle tissues.
Target Synonyms
PHKA2; PHKLA; PYKPhosphorylase b kinase regulatory subunit alpha; liver isoform; Phosphorylase kinase alpha L subunit
Target Background
Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the hepatic isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9A, also known as X-linked liver glycogenosis. Alternatively spliced transcript variants have been reported, but the full-length nature of these variants has not been determined.
Notification