-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIGZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-579 of human PIGZ (NP_079439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIGZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-579 of human PIGZ (NP_079439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05650A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIGZ |
| Target Synonyms | SMP3; PIG-Z; GPI-MT-IV; PIGZ | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 435-579 of human PIGZ (NP_079439.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGAPVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSLLSGAWRDHLSLHIVELGEET | Uniprot ID | Q86VD9 |
Uniprot Id
Q86VD9
Target Species
Human
Target Name
PIGZ
Target Full Name
GPI mannosyltransferase 4
Target Function
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers a fourth mannose to some trimannosyl-GPIs during GPI precursor assembly. The presence of a fourth mannose in GPI is facultative and only scarcely detected, suggesting that it only exists in some tissues.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Glycosyltransferase 22 family, PIGZ subfamily
Target Tissue Specificity
Widely expressed at low level, with highest level in brain and colon.
Target Synonyms
PIGZ; SMP3; GPI mannosyltransferase 4; EC 2.4.1.-; GPI mannosyltransferase IV; GPI-MT-IV; Phosphatidylinositol-glycan biosynthesis class Z protein; PIG-Z; SMP3 homolog; hSMP3
Target Background
The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
Notification