-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMAIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-54 of human PMAIP1 (NP_066950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PMAIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-54 of human PMAIP1 (NP_066950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12622A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMAIP1 |
| Target Synonyms | APR; NOXA; PMAIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-54 of human PMAIP1 (NP_066950.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT | Uniprot ID | Q13794 |
Uniprot Id
Q13794
Target Species
Human
Target Name
PMAIP1
Target Full Name
Phorbol-12-myristate-13-acetate-induced protein 1
Target Function
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
Target Subcellular Location
Mitochondrion.
Target Protein Families
PMAIP1 family
Target Tissue Specificity
Highly expressed in adult T-cell leukemia cell line.
Target Synonyms
Adult T cell leukemia derived PMA responsive; APR; APR_HUMAN; ATL-derived; Immediate early response protein APR; Immediate-early-response protein APR; NOXA; Phorbol 12 myristate 13 acetate induced protein 1; Phorbol-12-myristate-13-acetate-induced protein 1; PMA induced protein 1; PMA-induced protein 1; PMA-responsive gene; Pmaip1; Protein Noxa
Target Background
This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state.
Notification