-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human POLR2D (NP_004796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against POLR2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human POLR2D (NP_004796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-09949A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR2D |
| Target Synonyms | RBP4; RPB4; RPB16; HSRBP4; HSRPB4; POLR2D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF-7, Mouse spleen, SK-HEPC, SW480, SW620 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human POLR2D (NP_004796.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY | Uniprot ID | O15514 |
Uniprot Id
O15514
Target Species
Human
Target Name
POLR2D
Target Full Name
DNA-directed RNA polymerase II subunit RPB4
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Eukaryotic RPB4 RNA polymerase subunit family
Target Synonyms
DNA directed RNA polymerase II 16 kDa polypeptide; DNA directed RNA polymerase II subunit D; DNA directed RNA polymerase II subunit RPB4; DNA-directed RNA polymerase II 16 kDa polypeptide ; DNA-directed RNA polymerase II subunit D; DNA-directed RNA polymerase II subunit rpb4; HSRBP4; HSRPB4; polr2d; polymerase RNA II DNA directed polypeptide D; RBP4; RNA polymerase II 16 kDa subunit; RNA polymerase II subunit B4; RNA polymerase II subunit D; RNA polymerase II subunit hsRBP4; RPB16; RPB4_HUMAN
Target Background
This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene.
Notification