Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human POP7 (NP_005828.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human POP7 (NP_005828.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00140A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POP7 |
| Target Synonyms | RPP2; RPP20; 0610037N12Rik; POP7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human POP7 (NP_005828.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK | Uniprot ID | O75817 |
Uniprot Id
O75817
Target Species
Human
Target Name
POP7
Target Full Name
Ribonuclease P protein subunit p20
Target Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Cytoplasmic granule.
Target Protein Families
Histone-like Alba family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
0610037N12Rik; hPOP7; POP7 (processing of precursor, S. cerevisiae) homolog; POP7; POP7_HUMAN; processing of precursor 7 ribonuclease P subunit (S. cerevisiae); processing of precursor 7, S. cerevisiae, homolog of; Ribonuclease P protein subunit p20; Ribonuclease P, 20-KD subunit; Ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20; RPP2; RPP20
Target Background
Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Located in nucleolus. Part of multimeric ribonuclease P complex and ribonuclease MRP complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
