Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human PPBP (NP_002695.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human PPBP (NP_002695.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPBP |
| Target Synonyms | PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; PPBP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human PPBP (NP_002695.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD | Uniprot ID | P02775 |
Uniprot Id
P02775
Target Species
Human
Target Name
PPBP
Target Full Name
Platelet basic protein
Target Function
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Research Area
Immunology
Target Synonyms
B TG1; Beta TG ; Beta thromboglobulin; Beta-TG; C-X-C motif chemokine 7; Chemokine (C X C motif) ligand 7; Connective tissue activating peptide III; CTAP 3; CTAP III; CTAP-III; CTAP-III(1-81); CTAP3; CTAPIII; CXC chemokine ligand 7; CXCL 7; CXCL7; CXCL7_HUMAN; LA PF 4; LA-PF4; LDGF; Leukocyte derived growth factor; Leukocyte-derived growth factor; Low-affinity platelet factor IV; Macrophage-derived growth factor; MDGF; NAP 2; NAP-2; NAP-2(1-63); NAP-2(1-66); NAP-2(73); NAP-2(74); Neutrophil activating peptide 2; Neutrophil-activating peptide 2(1-63); PBP; Platelet basic protein; PPBP; Pro platelet basic protein (chemokine (C-X-C motif) ligand 7); Pro platelet basic protein; SCYB7; Small inducible cytokine subfamily B member 7; Small-inducible cytokine B7; TC1; TC2; TGB; TGB1; THBGB; THBGB1; Thrombocidin 1; Thrombocidin 2; Thromboglobulin; beta-1
Target Background
The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
