Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPN14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-810 of human PTPN14 (NP_005392.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTPN14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-810 of human PTPN14 (NP_005392.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11001A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPN14 |
| Target Synonyms | PEZ; PTP36; PTPD2; CATLPH; PTPN14 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 650-810 of human PTPN14 (NP_005392.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRGMEAMTLKSLHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPESVPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTDPPAVNGASLGPSISE | Uniprot ID | Q15678 |
Uniprot Id
Q15678
Target Species
Human
Target Name
PTPN14
Target Full Name
Tyrosine-protein phosphatase non-receptor type 14
Target Function
Protein tyrosine phosphatase which may play a role in the regulation of lymphangiogenesis, cell-cell adhesion, cell-matrix adhesion, cell migration, cell growth and also regulates TGF-beta gene expression, thereby modulating epithelial-mesenchymal transition. Mediates beta-catenin dephosphorylation at adhesion junctions. Acts as a negative regulator of the oncogenic property of YAP, a downstream target of the hippo pathway, in a cell density-dependent manner. May function as a tumor suppressor.
Target Involvement
Choanal atresia and lymphedema (CHATLY)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Note=Translocation into the nucleus is associated with induction of cell proliferation. Partially colocalized with actin filaments at the plasma membrane.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class subfamily
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
Cytoskeletal associated protein tyrosine phosphatase; MGC126803; PEZ; Phosphatase with ezrin domain; Protein tyrosine phosphatase non receptor type 14; Protein tyrosine phosphatase pez; Protein-tyrosine phosphatase pez; PTN14_HUMAN; PTP 36; PTP36; PTPD 2; PTPN 14; PTPN14; Tyrosine protein phosphatase non receptor type 14; Tyrosine-protein phosphatase non-receptor type 14
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. It appears to regulate lymphatic development in mammals, and a loss of function mutation has been found in a kindred with a lymphedema-choanal atresia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
