-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-142 of human PTPRA (NP_543031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PTPRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-142 of human PTPRA (NP_543031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04442A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPRA |
| Target Synonyms | LRP; HLPR; PTPA; HEPTP; HPTPA; RPTPA; PTPRL2; HPTPalpha; R-PTP-alpha; PTPRA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, BT-474, Mouse brain, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-142 of human PTPRA (NP_543031.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETP | Uniprot ID | P18433 |
Uniprot Id
P18433
Target Species
Human
Target Name
PTPRA
Target Full Name
Receptor-type tyrosine-protein phosphatase alpha
Target Function
Tyrosine protein phosphatase which is involved in integrin-mediated focal adhesion formation. Following integrin engagement, specifically recruits BCAR3, BCAR1 and CRK to focal adhesions thereby promoting SRC-mediated phosphorylation of BRAC1 and the subsequent activation of PAK and small GTPase RAC1 and CDC42.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, focal adhesion.
Target Protein Families
Protein-tyrosine phosphatase family, Receptor class 4 subfamily
Target Synonyms
PTPRA; PTPA; PTPRL2; Receptor-type tyrosine-protein phosphatase alpha; Protein-tyrosine phosphatase alpha; R-PTP-alpha
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported.
Notification