-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00660A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB12 |
| Target Synonyms | RAB12 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA | Uniprot ID | Q6IQ22 |
Uniprot Id
Q6IQ22
Target Species
Human
Target Name
RAB12
Target Full Name
Ras-related protein Rab-12
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy.
Target Subcellular Location
Recycling endosome membrane; Lipid-anchor; Cytoplasmic side. Lysosome membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome.
Target Protein Families
Small GTPase superfamily, Rab family
Target Research Area
Neuroscience
Target Synonyms
Putative Ras related protein Rab 12; RAB12; RAB12; member RAS oncogene family; RAB12_HUMAN; Ras-related protein Rab-12
Target Background
Enables GDP binding activity. Predicted to be involved in several processes, including cellular response to insulin stimulus; endosome to lysosome transport; and secretion by cell. Predicted to act upstream of or within cellular response to interferon-gamma. Predicted to be located in lysosome; phagocytic vesicle; and recycling endosome membrane. Predicted to be active in Golgi apparatus; cytoplasmic vesicle; and plasma membrane.
Notification