-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-211 of human RAB38 (NP_071732.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-211 of human RAB38 (NP_071732.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00246A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB38 |
| Target Synonyms | rrGTPbp; NY-MEL-1; RAB38 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, A375, MCF7, Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 92-211 of human RAB38 (NP_071732.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS | Uniprot ID | P57729 |
Uniprot Id
P57729
Target Species
Human
Target Name
RAB38
Target Full Name
Ras-related protein Rab-38
Target Function
May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Involved in peripheral melanosomal distribution of TYRP1 in melanocytes; the function, which probably is implicating vesicle-trafficking, includes cooperation with ANKRD27 and VAMP7. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays an important role in the control of melanin production and melanosome biogenesis. In concert with RAB32, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Melanosome. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side. Melanosome membrane.
Target Protein Families
Small GTPase superfamily, Rab family
Target Tissue Specificity
Expressed in melanocytes.
Target Synonyms
Antigen NY MEL 1 ; Melanoma antigen NY MEL 1; Melanoma antigen NY-MEL-1; NY MEL 1; RAB 38; Rab related GTP binding protein; Rab38; RAB38 member RAS oncogene family; RAB38_HUMAN; Ras related protein Rab 38; Ras-related protein Rab-38; rrGTPbp
Target Background
Enables several functions, including AP-1 adaptor complex binding activity; AP-3 adaptor complex binding activity; and BLOC-2 complex binding activity. Involved in several processes, including endosome to melanosome transport; melanosome assembly; and phagosome acidification. Located in several cellular components, including cytoplasmic vesicle; lysosome; and mitochondria-associated endoplasmic reticulum membrane.
Notification