-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RFX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-450 of human RFX2 (NP_000626.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RFX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-450 of human RFX2 (NP_000626.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RFX2 |
| Target Synonyms | RFX2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 295-450 of human RFX2 (NP_000626.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQTMAVQSQHHQQYIDVSHVFPEFPAPDLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDPEGAVLPKDKLISLCQCDPILRWMRSCDHIL | Uniprot ID | P48378 |
Uniprot Id
P48378
Target Species
Human
Target Name
RFX2
Target Full Name
DNA-binding protein RFX2
Target Function
Transcription factor that acts as a key regulator of spermatogenesis. Acts by regulating expression of genes required for the haploid phase during spermiogenesis, such as genes required for cilium assembly and function. Recognizes and binds the X-box, a regulatory motif with DNA sequence 5'-GTNRCC(0-3N)RGYAAC-3' present on promoters. Probably activates transcription of the testis-specific histone gene H1-6.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
RFX family
Target Synonyms
DNA-binding protein RFX2; HLA class II regulatory factor RFX2; regulatory factor X 2 (influences HLA class II expression); Regulatory factor X 2; regulatory factor X2; RFX2; RFX2_HUMAN; trans acting regulatory factor 2
Target Background
This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites.
Notification