-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RLN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RLN1 (NP_008842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RLN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RLN1 (NP_008842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04888A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RLN1 |
| Target Synonyms | H1; H1RLX; RLXH1; bA12D24.3.1; bA12D24.3.2; RLN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RLN1 (NP_008842.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKA | Uniprot ID | P04808 |
Uniprot Id
P04808
Target Species
Human
Target Name
RLN1
Target Full Name
Prorelaxin H1
Target Function
Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
Target Subcellular Location
Secreted.
Target Protein Families
Insulin family
Target Tissue Specificity
Prostate. Not expressed in placenta, decidua or ovary.
Target Synonyms
H1; H1RLX; Preprorelaxin H1; Prorelaxin; Prorelaxin H1; REL1_HUMAN; Relaxin A chain; Relaxin H1; RLN 1; Rln1; RLXH1
Target Background
Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by this gene is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin.
Notification