Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPRM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human RPRM (NP_062819.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPRM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human RPRM (NP_062819.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPRM |
| Target Synonyms | REPRIMO; RPRM | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human RPRM (NP_062819.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY | Uniprot ID | Q9NS64 |
Uniprot Id
Q9NS64
Target Species
Human
Target Name
RPRM
Target Full Name
Protein reprimo
Target Function
May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.
Target Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.
Target Protein Families
Reprimo family
Target Synonyms
RPRM; Protein reprimo
Target Background
Predicted to be involved in regulation of mitotic cell cycle. Predicted to act upstream of or within regulation of cell cycle. Predicted to be integral component of membrane. Predicted to be active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
