Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RTBDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-261 of human RTBDN (NP_113617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RTBDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-261 of human RTBDN (NP_113617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04992A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RTBDN |
| Target Synonyms | RTBDN; retbindin | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 63-261 of human RTBDN (NP_113617.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP | Uniprot ID | Q9BSG5 |
Uniprot Id
Q9BSG5
Target Species
Human
Target Name
RTBDN
Target Full Name
Retbindin
Target Function
Riboflavin-binding protein which might have a role in retinal flavin transport.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix. Cell membrane; Peripheral membrane protein.
Target Protein Families
Folate receptor family
Target Tissue Specificity
Expressed in peripheral retina (at protein level).
Target Synonyms
RTBDNRetbindin
Target Background
This gene was first identified in a study of human eye tissues. The protein encoded by this gene is preferentially expressed in the retina and may play a role in binding retinoids and other carotenoids as it shares homology with riboflavin binding proteins. Alternative splicing results in multiple transcript variants and protein isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
