-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against S100A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07915A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A11 |
| Target Synonyms | MLN70; S100C; HEL-S-43; S100A11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, Mouse lung(negative) | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT | Uniprot ID | P31949 |
Uniprot Id
P31949
Target Species
Human
Target Name
S100A11
Target Full Name
Protein S100-A11
Target Function
Facilitates the differentiation and the cornification of keratinocytes.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
S-100 family
Target Research Area
Signal Transduction
Target Synonyms
Calgizzarin; Epididymis secretory protein Li 43; HEL S 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70; Protein S100 A11; Protein S100-A11; Protein S100-A11, N-terminally processed; Protein S100-C; Protein S100A11; Protein S100C; S100 A11; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100a11; S100C; S10AB_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Notification