-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC61B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SEC61B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07880A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC61B |
| Target Synonyms | SEC61B; Sec61 translocon beta subunit | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Mouse stomach, Rat liver, Rat stomach, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS | Uniprot ID | P60468 |
Uniprot Id
P60468
Target Species
Human
Target Name
SEC61B
Target Full Name
Protein transport protein Sec61 subunit beta
Target Function
Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER). Component of a ribosome-associated ER translocon complex involved in multi-pass membrane protein transport into the ER membrane and biogenesis. The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER. Required for PKD1/Polycystin-1 biogenesis.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
SEC61-beta family
Target Synonyms
SEC61B; Protein transport protein Sec61 subunit beta
Target Background
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.
Notification