-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH2D2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SH2D2A (NP_003966.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SH2D2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SH2D2A (NP_003966.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10565A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH2D2A |
| Target Synonyms | SCAP; TSAD; VRAP; F2771; SH2D2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse spleen, Rat thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SH2D2A (NP_003966.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ | Uniprot ID | Q9NP31 |
Uniprot Id
Q9NP31
Target Species
Human
Target Name
SH2D2A
Target Full Name
SH2 domain-containing protein 2A
Target Function
Could be a T-cell-specific adapter protein involved in the control of T-cell activation. May play a role in the CD4-p56-LCK-dependent signal transduction pathway. Could also play an important role in normal and pathological angiogenesis. Could be an adapter protein that facilitates and regulates interaction of KDR with effector proteins important to endothelial cell survival and proliferation.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expression limited to tissues of the immune system and, in particular, activated T-cells. Expressed in peripheral blood leukocytes, thymus and spleen. Much lower expression or undetectable, in brain, placenta, skeletal muscle, prostate, testis, ovary, sma
Target Synonyms
F2771; SCAP; SH2 domain containing adapter protein; SH2 domain containing protein 2A; SH2 domain protein 2A; SH2 domain-containing adapter protein; SH2 domain-containing protein 2A; SH22A_HUMAN; Sh2d2a; T cell specific adapter protein; T cell specific adapter protein TSAd; T cell specific adpater protein TSAd; T cell-specific adapter protein; T lymphocyte specific adaptor protein; TSAd; VEGF receptor associated protein; VEGF receptor-associated protein; VRAP
Target Background
This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants.
Notification