-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC1A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 154-224 of human SLC1A5 (NP_005619.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC1A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 154-224 of human SLC1A5 (NP_005619.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11616A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC1A5 |
| Target Synonyms | R16; AAAT; ATBO; M7V1; RDRC; ASCT2; M7VS1; SLC1A5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 154-224 of human SLC1A5 (NP_005619.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ | Uniprot ID | Q15758 |
Uniprot Id
Q15758
Target Species
Human
Target Name
SLC1A5
Target Full Name
Neutral amino acid transporter B(0)
Target Function
Sodium-dependent amino acids transporter that has a broad substrate specificity, with a preference for zwitterionic amino acids. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated, anionic, and cationic amino acids. Through binding of the fusogenic protein syncytin-1/ERVW-1 may mediate trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development.; (Microbial infection) Acts as a cell surface receptor for Feline endogenous virus RD114.; (Microbial infection) Acts as a cell surface receptor for Baboon M7 endogenous virus.; (Microbial infection) Acts as a cell surface receptor for type D simian retroviruses.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A5 subfamily
Target Tissue Specificity
Placenta, lung, skeletal muscle, kidney, pancreas, and intestine.
Target Synonyms
ASCT2; AAAT; AAAT_HUMAN; ATB(0); ATBO; Baboon M7 virus receptor; FLJ31068; M7V1; M7VS1; Neutral amino acid transporter B(0); R16; RD114/simian type D retrovirus receptor; RDR; RDRC; SLC1A5; Sodium dependent neutral amino acid transporter type 2; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 (neutral amino acid transporter); member 5; Solute carrier family 1 member 5
Target Background
The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).
Notification