-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SON was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human SON (NP_001278340.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SON was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human SON (NP_001278340.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06697A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SON |
| Target Synonyms | SON3; BASS1; DBP-5; NREBP; TOKIMS; C21orf50; SON | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human SON (NP_001278340.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYR | Uniprot ID | P18583 |
Uniprot Id
P18583
Target Species
Human
Target Name
SON
Target Full Name
Protein SON
Target Function
RNA-binding protein that acts as a mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites. Specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG. Probably acts by facilitating the interaction between Serine/arginine-rich proteins such as SRSF2 and the RNA polymerase II. Also binds to DNA; binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3'. May indirectly repress hepatitis B virus (HBV) core promoter activity and transcription of HBV genes and production of HBV virions. Essential for correct RNA splicing of multiple genes critical for brain development, neuronal migration and metabolism, including TUBG1, FLNA, PNKP, WDR62, PSMD3, PCK2, PFKL, IDH2, and ACY1
Target Involvement
ZTTK syndrome (ZTTKS)
Target Subcellular Location
Nucleus speckle. Note=Colocalizes with the pre-mRNA splicing factor SRSF2.
Target Tissue Specificity
Widely expressed, with the higher expression seen in leukocyte and heart.
Target Synonyms
BASS1; Bax antagonist selected in saccharomyces 1; DBP-5; Negative regulatory element-binding protein; NRE-binding protein; Protein DBP-5; Protein SON; SON; SON protein; SON_HUMAN; SON3
Notification