-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03995A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAM |
| Target Synonyms | STAM1; STAM-1; STAM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Jurkat, Mouse pancreas, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH | Uniprot ID | Q92783 |
Uniprot Id
Q92783
Target Species
Human
Target Name
STAM
Target Full Name
Signal transducing adapter molecule 1
Target Function
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
Target Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
STAM family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp686J2352; HSE1 homolog; OTTHUMP00000019237; Signal transducing adapter molecule 1; signal transducing adaptor molecule (SH3 domain and ITAM motif) 1; STAM 1; STAM; STAM-1; STAM1_HUMAN
Target Background
This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene.
Notification