-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAU2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STAU2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00001A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAU2 |
| Target Synonyms | 39K2; 39K3; STAU2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Rat heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG | Uniprot ID | Q9NUL3 |
Uniprot Id
Q9NUL3
Target Species
Human
Target Name
STAU2
Target Full Name
Double-stranded RNA-binding protein Staufen homolog 2
Target Function
RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus. Endoplasmic reticulum.
Target Synonyms
39K2; 39K3; DKFZp781K0371; Double stranded RNA binding protein Staufen homolog 2; Double-stranded RNA-binding protein Staufen homolog 2; MGC119606; STAU 2; stau2; STAU2_HUMAN; Staufen (Drosophila; RNA-binding protein) homolog 2; Staufen double-stranded RNA binding protein 2; Staufen homolog 2; Staufen RNA binding protein homolog 2; Staufen; RNA binding protein; homolog 2 (Drosophila)
Target Background
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene.
Notification