-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Surfactant protein D/SP-D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-220 of human Surfactant protein D/SP-D (NP_003010.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Surfactant protein D/SP-D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-220 of human Surfactant protein D/SP-D (NP_003010.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04550A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Surfactant protein D/SP-D |
| Target Synonyms | SP-D; PSP-D; SFTP4; COLEC7; Surfactant protein D/SP-D | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-220 of human Surfactant protein D/SP-D (NP_003010.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESG | Uniprot ID | P35247 |
Uniprot Id
P35247
Target Species
Human
Target Name
SFTPD
Target Full Name
Pulmonary surfactant-associated protein D
Target Function
Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Target Protein Families
SFTPD family
Target Tissue Specificity
Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes).
Target Research Area
Cancer
Target Synonyms
COLEC 7; COLEC7; Collectin-7; Collectin7; Lung surfactant protein D; PSP D; PSP-D; PSP-D Surfactant protein D; PSPD; Pulmonary surfactant apoprotein; Pulmonary surfactant associated protein D; Pulmonary surfactant associated protein PSP-D; Pulmonary surfactant-associated protein D; SFTP 4; SFTP4; SFTPD; SFTPD_HUMAN; SP D; SP-D; Surfactant associated protein pulmonary 4; Surfactant protein D; Surfactant pulmonary associated protein D
Target Background
The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism.
Notification