-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Syntrophin alpha 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Syntrophin alpha 1 (NP_003089.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Syntrophin alpha 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Syntrophin alpha 1 (NP_003089.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04016A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Syntrophin alpha 1 |
| Target Synonyms | SNT1; LQT12; TACIP1; dJ1187J4.5; Syntrophin alpha 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, Mouse brain, Mouse skeletal muscle, Rat kidney, Rat skeletal muscle, RD | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Syntrophin alpha 1 (NP_003089.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTV | Uniprot ID | Q13424 |
Uniprot Id
Q13424
Target Species
Human
Target Name
SNTA1
Target Full Name
Alpha-1-syntrophin
Target Function
Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the extracellular matrix via the dystrophin glycoprotein complex. Plays an important role in synapse formation and in the organization of UTRN and acetylcholine receptors at the neuromuscular synapse. Binds to phosphatidylinositol 4,5-bisphosphate.
Target Involvement
Long QT syndrome 12 (LQT12)
Target Subcellular Location
Cell membrane, sarcolemma; Peripheral membrane protein; Cytoplasmic side. Cell junction. Cytoplasm, cytoskeleton.
Target Protein Families
Syntrophin family
Target Tissue Specificity
High expression in skeletal muscle and heart. Low expression in brain, pancreas, liver, kidney and lung. Not detected in placenta.
Target Synonyms
59 kDa dystrophin-associated protein A1 acidic component 1; Acidic alpha 1 syntrophin; Alpha 1 syntrophin; Alpha-1-syntrophin; dJ1187J4.5; Dystrophin associated protein A1 59kDa acidic component; LQT12; OTTHUMP00000030650; Pro-TGF-alpha cytoplasmic domain-interacting protein 1; SNT1; Snta1; SNTA1_HUMAN; Syntrophin 1; Syntrophin-1; TACIP1
Target Background
Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues. The N-terminal PDZ domain of this syntrophin protein interacts with the C-terminus of the pore-forming alpha subunit (SCN5A) of the cardiac sodium channel Nav1.5. This protein also associates cardiac sodium channels with the nitric oxide synthase-PMCA4b (plasma membrane Ca-ATPase subtype 4b) complex in cardiomyocytes. This gene is a susceptibility locus for Long-QT syndrome (LQT) - an inherited disorder associated with sudden cardiac death from arrhythmia - and sudden infant death syndrome (SIDS). This protein also associates with dystrophin and dystrophin-related proteins at the neuromuscular junction and alters intracellular calcium ion levels in muscle tissue.
Notification