-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAF13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00955A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAF13 |
| Target Synonyms | MRT60; TAF2K; TAFII18; TAFII-18; TAF(II)18; TAF13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse pancreas, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS | Uniprot ID | Q15543 |
Uniprot Id
Q15543
Target Species
Human
Target Name
TAF13
Target Full Name
Transcription initiation factor TFIID subunit 13
Target Function
Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells.
Target Involvement
Mental retardation, autosomal recessive 60 (MRT60)
Target Subcellular Location
Nucleus.
Target Protein Families
TAF13 family
Target Synonyms
MGC22425 ; TAF(II)18; taf13; TAF13 RNA polymerase II; TATA box binding protein (TBP) associated factor; 18kDa; TAF13_HUMAN; TAF2K; TAFII 18; TAFII-18; TAFII18; Transcription initiation factor TFIID 18 kDa subunit; Transcription initiation factor TFIID subunit 13
Target Background
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6.
Notification