-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human TGIF1 (NP_733796.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TGIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human TGIF1 (NP_733796.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04185A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGIF1 |
| Target Synonyms | HPE4; TGIF; TGIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, K-562, MCF7, Mouse liver, Mouse testis, Rat uterus, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human TGIF1 (NP_733796.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDT | Uniprot ID | Q15583 |
Uniprot Id
Q15583
Target Species
Human
Target Name
TGIF1
Target Full Name
Homeobox protein TGIF1
Target Function
Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. Active transcriptional corepressor of SMAD2. Links the nodal signaling pathway to the bifurcation of the forebrain and the establishment of ventral midline structures. May participate in the transmission of nuclear signals during development and in the adult, as illustrated by the down-modulation of the RXR alpha activities.
Target Involvement
Holoprosencephaly 4 (HPE4)
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/TGIF homeobox family
Target Synonyms
5' TG 3' interacting factor; 5''-TG-3''-interacting factor 1; Homeobox protein TGIF ; Homeobox protein TGIF1; HPE4; MGC39747; MGC5066; TALE homeobox TG-interacting factor; TG interacting factor isoform c; TG-interacting factor; TGFB induced factor ; TGFB-induced factor homeobox 1; TGIF1; TGIF1_HUMAN; transforming growth factor-beta-induced factor
Target Background
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described.
Notification