-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thioredoxin reductase 1 (TXNRD1 ) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Thioredoxin reductase 1 (TXNRD1 ) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11665A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thioredoxin reductase 1 (TXNRD1 ) |
| Target Synonyms | TR; TR1; TXNR; TRXR1; GRIM-12; Thioredoxin reductase 1 (TXNRD1 ) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, BxPC-3, HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV | Uniprot ID | Q16881 |
Uniprot Id
Q16881
Target Species
Human
Target Name
TXNRD1
Target Full Name
Thioredoxin reductase 1, cytoplasmic
Target Function
Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.
Target Subcellular Location
Cytoplasm.; [Isoform 4]: Cytoplasm. Nucleus.; [Isoform 5]: Cytoplasm.
Target Protein Families
Class-I pyridine nucleotide-disulfide oxidoreductase family
Target Tissue Specificity
Isoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus,
Target Research Area
Cell Biology
Target Synonyms
cytoplasmic; Gene associated with retinoic and IFN-induced mortality 12 protein; Gene associated with retinoic and interferon-induced mortality 12 protein; Gene associated with retinoid IFN induced mortality 12 protein; GRIM 12; GRIM-12; GRIM12; KDRF; KM 102 derived reductase like factor; KM-102-derived reductase-like factor; MGC9145; Oxidoreductase; Thioredoxin reductase 1; Thioredoxin reductase 1 cytoplasmic; Thioredoxin reductase GRIM 12; Thioredoxin reductase TR1; TR 1; TR; TR1; TRXR 1; TRXR1; TRXR1_HUMAN; TXNR; TXNRD 1; Txnrd1
Target Background
The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.
Notification