-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-211 of human TIMP3 (NP_000353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TIMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-211 of human TIMP3 (NP_000353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12473A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMP3 |
| Target Synonyms | SFD; K222; K222TA2; HSMRK222; TIMP3 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-211 of human TIMP3 (NP_000353.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP | Uniprot ID | P35625 |
Uniprot Id
P35625
Target Species
Human
Target Name
TIMP3
Target Full Name
Metalloproteinase inhibitor 3
Target Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Target Involvement
Sorsby fundus dystrophy (SFD)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Protease inhibitor I35 (TIMP) family
Target Research Area
Neuroscience
Target Synonyms
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein ; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3
Target Background
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Notification