-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFR1/TNFRSF1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TNFR1/TNFRSF1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFR1/TNFRSF1A |
| Target Synonyms | FPF; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1/TNFRSF1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, A-549 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR | Uniprot ID | P19438 |
Uniprot Id
P19438
Target Species
Human
Target Name
TNFRSF1A
Target Full Name
Tumor necrosis factor receptor superfamily member 1A
Target Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Target Involvement
Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Secreted. Note=A secreted form is produced through proteolytic processing.; [Isoform 4]: Secreted. Note=Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
Target Research Area
Apoptosis, Signal Transduction
Target Synonyms
CD120a; FPF; MGC19588; p55; p55-R; p60; TBP1; TBPI; TNF R; TNF R55; TNF-R1; TNF-RI; TNFAR; TNFR-I; TNFR1; TNFR55; TNFR60; TNFRI; TNFRSF1a; TNR1A_HUMAN; Tumor necrosis factor receptor 1; Tumor necrosis factor receptor superfamily, member 1A; Tumor necrosis factor receptor type 1; Tumor necrosis factor receptor type I; Tumor necrosis factor-binding protein 1
Target Background
This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mutations in this gene underlie tumor necrosis factor receptor-associated periodic syndrome (TRAPS), characterized by fever, abdominal pain and other features. Mutations in this gene may also be associated with multiple sclerosis in human patients.
Notification