-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRADD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-312 of human TRADD (NP_003780.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TRADD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-312 of human TRADD (NP_003780.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRADD |
| Target Synonyms | Hs.89862; TRADD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-312 of human TRADD (NP_003780.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA | Uniprot ID | Q15628 |
Uniprot Id
Q15628
Target Species
Human
Target Name
TRADD
Target Full Name
Tumor necrosis factor receptor type 1-associated DEATH domain protein
Target Function
Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B. The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytoskeleton.
Target Tissue Specificity
Found in all examined tissues.
Target Research Area
others
Target Synonyms
9130005N23Rik; AA930854; TNFR1 associated DEATH domain protein; TNFR1-associated DEATH domain protein; TNFRSF1A associated via death domain; TNFRSF1A-associated via death domain; tradd; TRADD_HUMAN; Tumor necrosis factor receptor type 1 associated DEATH domain protein; Tumor necrosis factor receptor type 1-associated DEATH domain protein
Target Background
The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
Notification