Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAPPC6A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human TRAPPC6A (NP_077013.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TRAPPC6A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human TRAPPC6A (NP_077013.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04610A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAPPC6A |
| Target Synonyms | TRS33; TRAPPC6A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human TRAPPC6A (NP_077013.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS | Uniprot ID | O75865 |
Uniprot Id
O75865
Target Species
Human
Target Name
TRAPPC6A
Target Full Name
Trafficking protein particle complex subunit 6A
Target Function
May play a role in vesicular transport during the biogenesis of melanosomes.
Target Subcellular Location
Golgi apparatus, cis-Golgi network. Endoplasmic reticulum.
Target Protein Families
TRAPP small subunits family, BET3 subfamily
Target Synonyms
TRAPPC6A; HSPC289; Trafficking protein particle complex subunit 6A; TRAPP complex subunit 6A
Target Background
This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
