Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGT2B17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against UGT2B17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HepG2 cells using UGT2B17 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
| Cat.No | ADA-07606A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGT2B17 |
| Target Synonyms | BMND12; UDPGT2B17; UGT2B17 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMS | Uniprot ID | O75795 |
Uniprot Id
O75795
Target Species
Human
Target Name
UGT2B17
Target Full Name
UDP-glucuronosyltransferase 2B17
Target Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol).
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
UDP-glycosyltransferase family
Target Tissue Specificity
Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.
Target Synonyms
UGT2B17; UDP-glucuronosyltransferase 2B17; UDPGT 2B17; UGT2B17; C19-steroid-specific UDP-glucuronosyltransferase; C19-steroid-specific UDPGT
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
