Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-460 of human UGT8 (NP_003351.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UGT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-460 of human UGT8 (NP_003351.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08737A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGT8 |
| Target Synonyms | CGT; UGT4; UGT8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-460 of human UGT8 (NP_003351.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHL | Uniprot ID | Q16880 |
Uniprot Id
Q16880
Target Species
Human
Target Name
UGT8
Target Full Name
2-hydroxyacylsphingosine 1-beta-galactosyltransferase
Target Function
Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides.
Target Subcellular Location
Membrane; Single-pass membrane protein. Endoplasmic reticulum.
Target Protein Families
UDP-glycosyltransferase family
Target Synonyms
UGT8; CGT; UGT4; 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase
Target Background
The protein encoded by this gene belongs to the UDP-glycosyltransferase family. It catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central and peripheral nervous systems. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
