-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP9X/USP9Y was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against USP9X/USP9Y was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP9X/USP9Y |
| Target Synonyms | DFFRY; SPGFY2; USP9X/USP9Y | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ | Uniprot ID | O00507 |
Uniprot Id
O00507
Target Species
Human
Target Name
USP9Y
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 9Y
Target Function
May function as a ubiquitin-protein or polyubiquitin hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade. Deubiquitination of SMAD4 by USP9X re-empowers its competence to mediate TGF-beta signaling
Target Involvement
Spermatogenic failure Y-linked 2 (SPGFY2)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Widely expressed in embryonic and adult tissues.
Target Synonyms
AZF 1; AZF; AZF1; AZFA; Azoospermia factor 1; Deubiquitinating enzyme FAF Y; Deubiquitinating enzyme FAF-Y; DFFRY; Fat facets like; Fat facets like Drosophila; Fat facets protein related Y linked; Fat facets protein-related; Probable ubiquitin carboxyl terminal hydrolase FAF Y; Probable ubiquitin carboxyl-terminal hydrolase FAF-Y; SP 3; SP3; SPGFY2; Ubiquitin specific peptidase 9 Y linked; Ubiquitin specific processing protease FAF Y; Ubiquitin specific protease 9 Y chromosome; Ubiquitin thioesterase FAF Y; Ubiquitin thiolesterase FAF-Y; Ubiquitin-specific protease 9; Ubiquitin-specific-processing protease FAF-Y; USP 10; USP 9Y; USP10; USP9Y; USP9Y_HUMAN; Y chromosome; Y-linked
Notification