Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13479A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAT1 |
| Target Synonyms | VATI; T1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA | Uniprot ID | Q99536 |
Uniprot Id
Q99536
Target Species
Human
Target Name
VAT1
Target Full Name
Synaptic vesicle membrane protein VAT-1 homolog
Target Function
Possesses ATPase activity. Plays a part in calcium-regulated keratinocyte activation in epidermal repair mechanisms. Has no effect on cell proliferation. Negatively regulates mitochondrial fusion in cooperation with mitofusin proteins (MFN1-2).
Target Subcellular Location
Cytoplasm. Mitochondrion outer membrane; Peripheral membrane protein.
Target Protein Families
Zinc-containing alcohol dehydrogenase family, Quinone oxidoreductase subfamily
Target Tissue Specificity
Expressed in brain. Also expressed in glioblastoma cells.
Target Synonyms
VAT1; FLJ20230; Membrane protein of cholinergic synaptic vesicles; MGC124668; OTTMUSP00000002784; RP23-328K2.5; Synaptic vesicle membrane protein VAT 1 homolog; Synaptic vesicle membrane protein VAT-1 homolog; VAT 1; VAT1; VAT1_HUMAN; VATI; Vesicle amine transport protein 1; Vesicle amine transport protein 1 homolog (T. californica)
Target Background
Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
