-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YKL-40/CHI3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human YKL-40/CHI3L1 (NP_001267.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against YKL-40/CHI3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human YKL-40/CHI3L1 (NP_001267.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04526A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YKL-40/CHI3L1 |
| Target Synonyms | GP39; ASRT7; GP-39; YK-40; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39; YKL-40/CHI3L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human YKL-40/CHI3L1 (NP_001267.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHS | Uniprot ID | P36222 |
Uniprot Id
P36222
Target Species
Human
Target Name
CHI3L1
Target Full Name
Chitinase-3-like protein 1
Target Function
Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia-induced injury, inflammation and epithelial apoptosis in lung
Target Involvement
Asthma-related traits 7 (ASRT7); Schizophrenia (SCZD)
Target Subcellular Location
Secreted, extracellular space. Cytoplasm. Cytoplasm, perinuclear region. Endoplasmic reticulum.
Target Protein Families
Glycosyl hydrolase 18 family
Target Tissue Specificity
Present in activated macrophages, articular chondrocytes, synovial cells as well as in liver. Very low or undetectable expression in non-inflammatory colon. Undetectable in muscle tissues, lung, pancreas, mononuclear cells, or fibroblasts.
Target Research Area
Signal Transduction
Target Synonyms
39 kDa synovial protein; ASRT7; Cartilage glycoprotein 39; CGP-39; CGP39; CH3L1_HUMAN; CHI3L1; chitinase 3 like 1 (cartilage glycoprotein 39) ; chitinase 3 like 1; Chitinase 3 like protein 1 precursor ; chitinase; Chitinase-3-like protein 1; Chondrocyte protein YKL40; GP 39; GP-39; GP39; HC gp39 ; HCGP 3P ; hCGP-39; HCgp39; YKL 40; YKL-40; YKL40; YYL 40
Notification