Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mrpl18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-180 of mouse Mrpl18 (NP_080586.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Mrpl18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-180 of mouse Mrpl18 (NP_080586.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07218A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL18 |
| Target Synonyms | HSPC071; MRP-L18; 1010001C05Rik; Mrpl18 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, MCF7, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-180 of mouse Mrpl18 (NP_080586.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE | Uniprot ID | Q9CQL5 |
Uniprot Id
Q9CQL5
Target Synonyms
HSPC071; MRP-L18; 1010001C05Rik; Mrpl18
Target Background
Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain; connective tissue; early conceptus; genitourinary system; and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
