Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIFY10A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 154-253 of arabidopsis thaliana TIFY10A (NP_564075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIFY10A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 154-253 of arabidopsis thaliana TIFY10A (NP_564075.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07920A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIFY10A |
| Target Synonyms | AtJAZ1; jasmonate-zim-domain protein 1; T29M8.5; T29M8_5; TIFY10A | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rosette leaf | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 154-253 of arabidopsis thaliana TIFY10A (NP_564075.1). | Immunogen Sequence | SKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI |
|---|---|---|---|
| Uniprot ID | Q9LMA8 |
Uniprot Id
Q9LMA8
Target Synonyms
AtJAZ1; jasmonate-zim-domain protein 1; T29M8.5; T29M8_5; TIFY10A
Target Background
JAZ1 is a nuclear-localized protein involved in jasmonate signaling. JAZ1 transcript levels rise in response to a jasmonate stimulus. JAZ1 can interact with the COI1 F-box subunit of an SCF E3 ubiquitin ligase in a yeast-two-hybrid assay only in the presence of jasmonate-isoleucine (JA-ILE) or coronatine. Application of jasmonate methyl ester to Arabidopsis roots reduces the levels of a JAZ1:GUS fusion protein, presumably by stimulating ubiquitin-proteasome-mediated degradation. The Jas domain appears to be important for JAZ1-COI1 interactions in the presence of coronatine. Two positive residues (R205 and R206) in the Jas domain shown to be important for coronatine -dependent COI1 binding are not required for binding AtMYC2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
